Human IL29 protein

Catalog Number: orb246588

Catalog Number	orb246588
Category	Proteins
Description	Recombinant human Interleukin-29
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	36 kDa
UniProt ID	Q8IU54
Protein Sequence	PVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 21-200aa. Protein Length: Partial
Expression Region	21-200aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	IL29 Read more...
Note	For research use only
Application notes	This is His-SUMO-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	21.1 kDa
Source:	Human IL-29, His Tag (orb257605) is expressed from human 293 cells (HEK293). It contains AA Gly 20 - Thr 200 (Accession # NP_742152.1).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Applications:	FA, HPLC, SDS-PAGE
Conjugation:	Unconjugated
Purity:	> 97% pure by SDS-PAGE and HPLC analyses.
MW:	19.8 kDa

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human IFNL1(Met1-Thr200) was fused with the C-terminal His Tag and expressed in Mammalian cells.