You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IGF1 protein (Active)
Catalog Number: orb359162
| Catalog Number | orb359162 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IGF1 active protein |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| MW | 7.4 kDa |
| UniProt ID | P05019 |
| Protein Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Protein Length | Partial |
| Source | E.Coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of ＞ 5.0 × 105 IU/mg. |
| Expression Region | 52-118aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Alternative names | IGF-I, MGF, Somatomedin-C Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human IGF1 protein (Active)
- Item 1 of 1
Human IGF1 protein [orb594726]
Greater than 95% as determined by SDS-PAGE.
7.3 kDa
E.coli
50 μg, 500 μg, 1 mg, 10 μg 
Recombinant Human Insulin-like growth factor I protein (IGF1),15N Stable Isotope Labeled (Active) [orb1785080]
Greater than 97% as determined by SDS-PAGE.
7.7 kDa
E.Coli
10 μg, 100 μg, 500 μgRecombinant Human Insulin-like growth factor I protein(IGF1) (Active) [orb1631369]
250 μg, 10 μg, 1 mg, 500 μg, 50 μgRecombinant Human Insulin-like growth factor I protein(IGF1) (Active) [orb1650681]
1 mg, 500 μg, 100 μg
