Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human IDH3B protein
Catalog Number orb244286
Species/HostHuman
ConjugationUnconjugated
Target IDH3B
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAG
Purity >90% as determined by SDS-PAGE.
MW 66.2 kDa
Source E. coli
Uniprot ID O43837
Product Description

Recombinant human Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial

Application Notes
Application Notes Full length of GST-tag and expression region is 35-385aa
Reviews
Write Your Own Review
You're reviewing:Human IDH3B protein - orb244286
Your Rating