Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human HSD17B10 protein
Catalog Number orb244939
Species/HostHuman
ConjugationUnconjugated
Target HSD17B10
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGA
Purity >90% as determined by SDS-PAGE.
MW 42.8 kDa
Source E. coli
Uniprot ID Q99714
Product Description

Recombinant human 3-hydroxyacyl-CoA dehydrogenase type-2

Application Notes
Application Notes This is His-SUMO-tag protein
Reviews
Write Your Own Review
You're reviewing:Human HSD17B10 protein - orb244939
Your Rating