Cart summary

You have no items in your shopping cart.

    Human HPRT1 Protein

    Human HPRT1 Protein

    Catalog Number: orb1477321

    DispatchUsually dispatched within 5-10 working days
    $ 1,771.00
    Catalog Numberorb1477321
    CategoryProteins
    DescriptionRecombinant Human Hypoxanthine-guanine phosphoribosyltransferase(HPRT1)
    TagN-terminal 10xHis-tagged
    Form/AppearanceLiquid or Lyophilized powder
    PurityGreater than 90% as determined by SDS-PAGE.
    MW31.7 kDa
    UniProt IDP00492
    Protein SequenceATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
    Protein LengthFull Length of Mature Protein
    SourceE.coli
    Expression SystemExpression Region: MHHHHHHHHHHKWFKIQMQIRRWKNKRGLFGAIAGFIEGGWTGMIDGGGGGSGFLGPAPAPAPAPA+2-218aa. Protein Length: Full Length of Mature Protein
    EndotoxinsNot test.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
    Alternative names(HGPRT)(HGPRTase)
    Read more...
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    • Human HPRT1 protein [orb704607]

      Greater than 90% as determined by SDS-PAGE.

      28.4 kDa

      E.coli

      20 μg, 100 μg, 1 mg
    • Human HPRT1 protein [orb391861]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      E. coli

      500 μg, 50 μg, 10 μg
    • Human HPRT1 Protein [orb1477319]

      Greater than 90% as determined by SDS-PAGE.

      32.7 kDa

      E.coli

      20 μg, 100 μg, 1 mg
    • Human HPRT1 Protein [orb1477320]

      Greater than 85% as determined by SDS-PAGE.

      32.7 kDa

      E.coli

      1 mg, 20 μg, 100 μg
    • Human HPRT1 Protein [orb1477033]

      Greater than 85% as determined by SDS-PAGE.

      29.0 kDa

      E.coli

      20 μg, 100 μg, 1 mg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars