You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human GYPA GPA protein
Catalog Number: orb246745
| Catalog Number | orb246745 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Glycophorin-A |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 9.9 kDa |
| UniProt ID | A0A0C4DFT7 |
| Protein Sequence | LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 20-91aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | GYPA GPA Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GYPA GPA.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GYPA GPA.
- Item 1 of 1
Human GYPA GPA protein [orb244257]
Greater than 90% as determined by SDS-PAGE.
34.9 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Human CD235A Protein, hFc Tag [orb1290967]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.3 kDa after removal of the signal peptide. The apparent molecular mass of CD235A-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human GYPA Protein [orb425923]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Insect cells
2 μg, 1 mg, 10 μg
