You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human GMPR protein
Catalog Number: orb244703
| Catalog Number | orb244703 |
|---|---|
| Category | Proteins |
| Description | Recombinant human GMP reductase 1 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS |
| Protein Length | Full Length |
| UniProt ID | P36959 |
| MW | 53.4 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-345aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | GMPR |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human GMPR protein [orb391811]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgHuman GMPR1 protein [orb754515]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
37.8 kDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μgHuman GMPR Protein, His Tag [orb2699786]
> 85%, determined by SDS-PAGE
This protein contains the human GMPR (Met1-Ser345) was expressed with a polyhistidine tag at the N-terminus and expressed from E. coli.
100 μg, 20 μgHuman GMPR Protein [orb425795]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
5 μg, 20 μg, 1 mg
