You have no items in your shopping cart.
Featured
Description
Research Area
Signal Transduction
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 1-124aa |
| Protein Length | Full Length of BC028113 |
| MW | 41.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), bA101E13.1, CGI133, Glrx2, GLRX2_HUMAN, Glutaredoxin-2, Glutaredoxin-2, mitochondrial, GRX2, mitochondrial
Similar Products
−- Item 1 of 2
Human GLRX2 Recombinant Protein (N-His) [orb2965224]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
15.96 kDa
50 μg, 100 μg, 1 mgRecombinant Human GLRX2 Protein, N-His [orb2821159]
>90% as determined by SDS-PAGE.
15.96 kDa
50 μg, 100 μg, 20 μgHuman GLRX2 Protein, His-IF2DI Tag [orb1291831]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
36.5 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mgHuman GLRX2 Protein [orb425759]
Purity of GRX2 is greater than 90% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 25 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks