You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human GLP1R protein
Catalog Number: orb245848
| Catalog Number | orb245848 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Glucagon-like peptide 1 receptor |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 16.3 kDa |
| UniProt ID | P43220 |
| Protein Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-145aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | GLP1R Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
Human GLP1R Protein, hFc Tag [orb1743290]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.7 kDa after removal of the signal peptide. The apparent molecular mass of GLP1R-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 2
Human GLP1R full length protein-synthetic nanodisc [orb1743150]
The human full length GLP1R protein has a MW of 53.0 kDa
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
Human GLP1R Protein [orb1476707]
Greater than 95% as determined by SDS-PAGE.
19.3 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 1
Human GLP1R protein [orb419298]
Greater than 85% as determined by SDS-PAGE.
16.8 kDa
Baculovirus
1 mg, 100 μg, 20 μg - Item 1 of 1
Human GLP1R protein [orb383448]
Greater than 90% as determined by SDS-PAGE.
18.3 kDa
Mammalian cell
20 μg, 1 mg, 100 μg
