You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human GADD45A protein
Catalog Number: orb244217
| Catalog Number | orb244217 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Growth arrest and DNA damage-inducible protein GADD45 alpha |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
| Protein Length | Full Length |
| UniProt ID | P24522 |
| MW | 34.3 kDa |
| Application notes | Full length of His-SUMO-tag and expression region is 1-165aa |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-165aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | GADD45A |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human GADD45A ELISA Kit [orb407075]
Human
25 pg/mL-1600 pg/mL
6.25 pg/mL
24 T, 10 x 96 T, 5 x 96 T, 48 T, 96 T- Item 1 of 1
- Item 1 of 1
Human Growth Arrest and DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit [orb780060]
Human
0.16-10 ng/mL
0.062 ng/mL
96 T, 48 T Human GADD45A protein [orb391770]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
