You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human Fusion glycoprotein F0 protein
Catalog Number: orb358287
| Catalog Number | orb358287 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Fusion glycoprotein F0 protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 50.1 kDa |
| UniProt ID | O36634 |
| Protein Sequence | FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLSLIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Human respiratory syncytial virus B (strain B1) |
| Expression Region | 137-574aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | FFusion glycoprotein F0, Protein F) [Cleaved into, Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human Fusion glycoprotein F0 protein [orb419334]
Greater than 90% as determined by SDS-PAGE.
69.9 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Human Fusion glycoprotein F0 protein [orb419341]
Greater than 85% as determined by SDS-PAGE.
60.8 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Virus F protein [orb604715]
Greater than 85% as determined by SDS-PAGE.
58.9 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human F protein [orb246832]
Greater than 90% as determined by SDS-PAGE.
57.9 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Human metapneumovirus Fusion glycoprotein F0 (F), partial [orb1674725]
Greater than 90% as determined by SDS-PAGE.
22.3 kDa
E.coli
1 mg, 20 μg, 100 μg
