You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FLT3LG protein
Catalog Number: orb418722
| Catalog Number | orb418722 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Fms-related tyrosine kinase 3 ligand |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP |
| Protein Length | Extracellular Domain |
| UniProt ID | P49771 |
| MW | 33.9 kDa |
| Application notes | Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 27-184aaSequence Info: Cytoplasmic Domain |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 27-184aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | SL cytokine |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human FLT3 Ligand Protein, mFc-His Tag [orb689394]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 45.6 kDa after removal of the signal peptide.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 2
FLT3LG purified MaxPab mouse polyclonal antibody (B01P) [orb2292986]
IF, WB
Human
Mouse
Polyclonal
Unconjugated
50 μg - Item 1 of 1
- Item 1 of 1
Recombinant human FLT3 Ligand protein (Active, HEK293) [orb1817179]
> 95% as determined by SDS-PAGE
24-30 kDa
10 μg, 500 μg, 50 μg 
Human FLT3LG protein [orb391754]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
