Human FGF8 protein

Catalog Number: orb594758

Catalog Number	orb594758
Category	Proteins
Description	Recombinant Human Fibroblast growth factor 8(FGF8),partial (Active)
Reactivity	Human
Tag	N-terminal 6xHis-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	27.7 kDa
UniProt ID	P55075
Protein Sequence	QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Protein Length	Partial of Isoform 4
Source	E.coli
Biological Activity	The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 0.5 ug/ml.
Expression Region	23-244aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Alternative names	Fibroblast growth factor 8;Androgen-induced growth Read more...
Note	For research use only
Application notes	Partial of Isoform 4
Expiration Date	6 months from date of receipt.

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	E. coli

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	22.5 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human FGF8(Gln23-Arg215) was fused without Tag and expressed in E. coli.