You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245431 |
---|---|
Category | Proteins |
Description | Recombinant human Fibroblast growth factor 5 protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 54.6 kDa |
UniProt ID | P12034 |
Protein Sequence | AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 18-268aa. Protein Length: Full Length of Mature Protein |
Expression Region | 18-268aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | FGF5 5 Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
> 90% as determined by SDS-PAGE | |
29.4 kDa | |
Human FGF-5 Protein, His Tag (orb1818948) is expressed from E. coli cells. It contains AA Glu 23 - Gly 268 (Accession # P12034-1). |
Greater than 85% as determined by SDS-PAGE. | |
62.4 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
27.5 kDa | |
E.Coli |
Filter by Rating