Human FCGRT protein

Catalog Number: orb245835

Catalog Number	orb245835
Category	Proteins
Description	Human FCGRT protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	32.4 kDa
UniProt ID	P55899
Protein Sequence	AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Protein Length	Extracellular Domain
Source	Yeast
Expression System	Expression Region: 24-297aa. Protein Length: Extracellular Domain
Expression Region	24-297aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Alpha chain protein, Fc fragment of IgG, receptor Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Purity:	> 97% by SDS-PAGE.
Source:	KMP1768, Recombinant Human FCGRT&B2M Protein is produced by HEK293 Cells expression system. The target heterodimer proteins are co-expressed with the sequence (Ala24-Ser297) of human FCGRT (Accession #NP_004098.1) fused with a 6×His Tag at the C-terminus and the sequence (Ile21-Met119) of human B2M (Accession #NP_004039.1).

Sizes Available: 100 μg, 50 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	57.4 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	34.4 kDa
Source:	Mammalian cell

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human FCGRT(Ala24-Leu290&Ile21-Met119) was fused with the C-terminal His Tag and expressed in Mammalian cells.