You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human DLL3 protein
Catalog Number: orb246199
| Catalog Number | orb246199 |
|---|---|
| Category | Proteins |
| Description | The |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 50.5 kDa |
| UniProt ID | Q9NYJ7 |
| Protein Sequence | AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 27-492aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | DLL3 protein Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
- Item 1 of 3
Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785016]
Greater than 95% as determined by SDS-PAGE.
11.7 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 3
Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785017]
Greater than 95% as determined by SDS-PAGE.
39.7 kDa
Mammalian cell
100 μg, 20 μg, 1 mg - Item 1 of 2
Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1095880]
Greater than 71.6% as determined by SDS-PAGE.
51.5 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 2
Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785018]
Greater than 95% as determined by SDS-PAGE.
8.1 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 2
Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785019]
Greater than 95% as determined by SDS-PAGE.
36.0 kDa
Mammalian cell
20 μg, 100 μg, 1 mg
