Human DLL3 protein

SKU: orb244977

Featured

Description

This Human DLL3 protein spans the amino acid sequence from region 27-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 1

Application Notes	This is His-SUMO-tag protein

Key Properties

−

Source	E.coli
Biological Origin	Homo sapiens (Human)
Tag	N-terminal 6xHis-SUMO-tagged
Molecular Weight	64.5 kDa
Expression Region	27-492aa
Protein Length	Extracellular Domain
Protein Sequence	AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

DLL3

Human DLL3 [orb2992983]

Conjugation:	Unconjugated
Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified). SEC-HPLC: Greater than 95% as determined by SEC-HPLC.(QC verified)
MW:	Predicted: 49.4 KDa. Observed: 43-55 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Item 1 of 3
Human DLL3 protein [orb246199]
Purity:
Greater than 90% as determined by SDS-PAGE.
MW:
50.5 kDa
Source:
Yeast
Sizes Available: 1 mg, 20 μg, 100 μg
Item 1 of 3
Recombinant Human Delta-like protein 3 (DLL3), partial (Active) [orb1785016]
Purity:
Greater than 95% as determined by SDS-PAGE.
MW:
11.7 kDa
Source:
Mammalian cell
Sizes Available: 1 mg, 100 μg, 20 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q9NYJ7

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols