You have no items in your shopping cart.
Cart summary
Human DLL3 protein
Catalog Number: orb244977
| Catalog Number | orb244977 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Delta-like protein 3 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 64.5 kDa |
| UniProt ID | Q9NYJ7 |
| Protein Sequence | AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
| Protein Length | Extracellular Domain |
| Source | E.coli |
| Expression System | Expression Region: 27-492aa. Protein Length: Extracellular Domain |
| Expression Region | 27-492aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | DLL3 Read more... |
| Note | For research use only |
| Application notes | This is His-SUMO-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human DLL3 protein [orb246199]
Greater than 90% as determined by SDS-PAGE.
50.5 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mg - Item 1 of 1
Recombinant Human Delta-like protein 3(DLL3), partial (Active) [orb1095880]
Greater than 71.6% as determined by SDS-PAGE.
51.5 kDa
Mammalian cell
20 μg, 100 μg, 1 mgRecombinant Human Delta-like protein 3 (DLL3), partial [orb1096514]
Greater than 85% as determined by SDS-PAGE.
24.2 kDa
E.coli
20 μg, 100 μg, 1 mgHuman DLL3 Protein, hFc Tag [orb1173856]
Unconjugated
The purity of the protein is greater than 80% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 74.4 kDa after removal of the signal peptide. The apparent molecular mass of DLL3-hFc is approximately 100-130 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars