You have no items in your shopping cart.
Cart summary
Human COPS2 protein
Catalog Number: orb419172
| Catalog Number | orb419172 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human COP9 signalosome complex subunit 2 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 53.6 kDa |
| UniProt ID | P61201 |
| Protein Sequence | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
| Protein Length | Full Length |
| Source | Yeast |
| Expression System | Expression Region: 1-443aa. Protein Length: Full Length |
| Expression Region | 1-443aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Alien homolog JAB1-containing signalosome subunit Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 1-443aaSequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
Human COPS2 protein [orb383404]
Greater than 90% as determined by SDS-PAGE.
67.6 kDa
E.coli
20 μg, 100 μg, 1 mgHuman COPS2 protein [orb419174]
Greater than 85% as determined by SDS-PAGE.
51.6 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human CSN2/COPS2 Protein, His Tag [orb1552619]
≥90% as determined by SDS-PAGE
This protein contains the human COPS2(Glu26-Val226) was fused with the N-terminal His Tag and expressed in E. coli.
100 μg, 50 μgCOPS2 Recombinant Protein (Human) [orb2052290]
Greater than 90% as determined by SDS-PAGE.
67.6 kDa
E.coli
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars