You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CLEC4C protein
Catalog Number: orb383167
| Catalog Number | orb383167 |
|---|---|
| Category | Proteins |
| Description | Recombinant human CLEC4C protein. |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 22 kDa |
| UniProt ID | Q8WTT0 |
| Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 45-213aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Blood dendritic cell antigen 2 Short name, BDCA-2 Read more... |
| Note | For research use only |
| Application notes | E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
Human CLEC4C protein [orb624085]
Greater than 90% as determined by SDS-PAGE.
36 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CLEC4C protein [orb358925]
Greater than 90% as determined by SDS-PAGE.
24 kDa
Mammalian cell
500 μg - Item 1 of 1
Human CLEC4C Protein, His Tag [orb1826832]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 20.8 kDa after removal of the signal peptide. The apparent molecular mass of CLEC4C-His is approximately 25-35 kDa due to glycosylation.
E.coli
10 μg, 50 μg, 100 μg - Item 1 of 1
Human CLEC4C Protein, hFc Tag [orb1290922]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg 
