You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CEACAM8 protein
Catalog Number: orb8750
| Catalog Number | orb8750 |
|---|---|
| Category | Proteins |
| Description | Recombinant of human CEACAM8 protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P31997 |
| RRID | AB_10925823 |
| MW | 47.5 kDa |
| Application notes | Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 35-320aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5 |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 35-320aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CD67 antigen Carcinoembryonic antigen CGM6 Non-spe Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Human CEACAM8 Protein, hFc Tag [orb1290998]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 57.5 kDa after removal of the signal peptide.The apparent molecular mass of CEACAM8-hFc is approximately 70-130 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human CEACAM8 Protein, His Tag [orb1291774]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.2 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM8-His is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human CEACAM8 protein [orb391464]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human CD66b/CEACAM8 Protein, N-His [orb2836024]
> 90% as determined by SDS-PAGE.
33.83 kDa
100 μg, 50 μg, 20 μg
