You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 113-201aa |
| Protein Length | Partial |
| MW | 25.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD81
Similar Products
−- Item 1 of 1
Human Target of the Antiproliferative Antibody 1 (TAPA1) ELISA Kit [orb777504]
Human
0.32-20 ng/mL
0.114 ng/mL
48 T, 96 T - Item 1 of 4
CD81 Human Monoclonal Antibody [orb2956674]
ELISA, FC, IHC, WB
Human
Human
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg 
Recombinant Human CD316 Protein [orb2994856]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 59.6 KDa. Observed: 70-85 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD81 Protein [orb2993741]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 36.1 KDa. Observed: 37 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD316 Protein [orb2993833]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 85.7 KDa. Observed: 90-120 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks