You have no items in your shopping cart.
Cart summary
Human CD70 protein
Catalog Number: orb245787
| Catalog Number | orb245787 |
|---|---|
| Category | Proteins |
| Description | Recombinant human CD70 antigen |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 19.1 kDa |
| UniProt ID | P32970 |
| Protein Sequence | QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Expression System | Expression Region: 39-193aa. Protein Length: Extracellular Domain |
| Expression Region | 39-193 |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD70 Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CD27 / TNFRSF7 Protein [orb257294]
Unconjugated
95%
45.9 kDa
Human CD27, Fc Tag (orb257294) is expressed from human 293 cells (HEK293). It contains AA Thr 21 - Ile 192 (Accession # NP_001233).
1 mg, 200 μg Human CD70 Protein, mFc-His Tag [orb689401]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 45.6 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman CD70 Protein, hFc-His Tag [orb689468]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.1 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman CD70 protein [orb391424]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgMouse CD70 Protein, hFc Tag [orb1826788]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mCD70 is approximately 35-70 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars