You have no items in your shopping cart.
Cart summary
Human CD7 protein
Catalog Number: orb245786
| Catalog Number | orb245786 |
|---|---|
| Category | Proteins |
| Description | Recombinant human T-cell antigen CD7 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 18.4 kDa |
| UniProt ID | P09564 |
| Protein Sequence | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
| Protein Length | Extracellular Domain |
| Source | Yeast |
| Expression System | Expression Region: 26-180aa. Protein Length: Extracellular Domain |
| Expression Region | 26-180aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD7 Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
Human CD7 protein [orb244091]
Greater than 90% as determined by SDS-PAGE.
32.4 kDa
E.coli
20 μg, 100 μg, 1 mgMouse CD7 Protein, hFc Tag [orb1173669]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.4 kDa after removal of the signal peptide. The apparent molecular mass of mCD7-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman CD7 protein [orb706899]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman CD7 Protein, mFc Tag [orb689450]
Unconjugated
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.7 kDa after removal of the signal peptide. The apparent molecular mass of CD7-mFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman CD7 protein [orb391423]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars