You have no items in your shopping cart.
Human CD3E protein
SKU: orb383281
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 13.8 kDa |
| Expression Region | 23-126aa |
| Protein Length | Extracellular Domain |
| Protein Sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD3E Proteins, CD3-epsilon Proteins, CD3 epsilon Proteins, CD3E Proteins, CD3E antigen epsilon polypeptide (TiT3 complex) Proteins, CD3E antigen epsilon polypeptide Proteins, CD3E antigen Proteins, epsilon subunit Proteins, CD3E molecule epsilon Proteins, CD3E molecule Proteins, epsilon (CD3 TCR complex) Proteins, CD3E molecule Proteins, epsilon (CD3-TCR complex) Proteins, CD3E_HUMAN Proteins, IMD18 Proteins, T cell antigen receptor complex epsilon subunit of T3 Proteins, T cell surface antigen T3/Leu 4 epsilon chain Proteins, T cell surface glycoprotein CD3 epsilon chain Proteins, T-cell surface antigen T3/Leu-4 epsilon chain Proteins, T-cell surface glycoprotein CD3 epsilon chain Proteins, T3E Proteins, TCRE Proteins
Similar Products
−- Item 1 of 4
- Item 1 of 3
- Item 1 of 3
CD3e Antibody [orb665922]
IF, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl - Item 1 of 3
Human CD3D Protein, His Tag and Human CD3E Protein, hFc Tag [orb1743385]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 10.4 and 37.9 kDa after removal of the signal peptide. The apparent molecular mass of CD3D-His and CD3E-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
Human CD3E & CD3G Heterodimer Protein, Fc-His Tag & Fc-Flag Tag [orb348813]
Unconjugated
95%
39.2 kDa (CD3E) & 38.6 kDa (CD3G)
50 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CD3E protein (orb383281)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks