You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CCND2 protein
Catalog Number: orb54241
| Catalog Number | orb54241 |
|---|---|
| Category | Proteins |
| Description | Recombinant human CCND2 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL |
| Protein Length | Full Length |
| UniProt ID | P30279 |
| MW | 60.1 kDa |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-354AA: 1-289AAFull Length : Full Length |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-289aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CCND 2, ccnd2, CCND2_HUMAN, CyclinD2, G1/S specifi Read more... |
| Research Area | Cell Biology |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human CCND2 protein [orb391379]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
50 μg, 500 μg, 10 μgRecombinant Human CCND2 Protein, His Tag [orb1552724]
≥90% as determined by SDS-PAGE
This protein contains the human CCND2(Met1-Leu289) was fused with the N-terminal His Tag and expressed in E. coli.
100 μg, 50 μgHuman CCND2 Protein [orb424541]
Greater than 85% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 20 μg
