Human CASP14 protein

SKU: orb382944

Description

This Human CASP14 protein spans the amino acid sequence from region 153-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal GST-tagged Full Length

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal GST-tagged
• Expression Region: 153-240aa
• Protein Length: Full Length of Mature Protein
• MW: 37.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Apoptosis related cysteine protease, CASP 14, CASP-14, CASP14, Caspase 14 apoptosis related cysteine protease, Caspase 14 precursor, Caspase-14 subunit p10, Caspase14, CASPE_HUMAN, MGC119078, MGC119079, MICE, Mini ICE

Quick Database Links

UniProt

P31944