Human C8G protein

Catalog Number: orb246304

Catalog Number	orb246304
Category	Proteins
Description	Recombinant human Complement component C8 gamma chain
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	36.4 kDa
UniProt ID	P07360
Protein Sequence	QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 21-202aa. Protein Length: Full Length of Mature Protein
Expression Region	21-202aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	C8G Read more...
Note	For research use only
Application notes	Full length of His-SUMO-tag and expression region is 21-202aa
Expiration Date	6 months from date of receipt.

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	22.9 kDa
Source:	Baculovirus

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	26.4 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	E. coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	23.9 kDa
Source:	Mammalian cell

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human C8G(Gln21-Arg202) was fused with the N-terminal His Tag and expressed in E. coli.