You have no items in your shopping cart.
Human BTF3 protein
SKU: orb245099
Featured
Description
Research Area
Epigenetics & Chromatin
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Molecular Weight | 44.3 kDa |
| Expression Region | 48-206aa |
| Protein Length | Partial |
| Protein Sequence | TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−BTF3 NACB OK, SW-cl.8
Similar Products
−- Item 1 of 2
- Item 1 of 1
Human BTN3A3 protein [orb358074]
Greater than 90% as determined by SDS-PAGE.
39.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human BTN3A3 protein [orb358227]
Greater than 90% as determined by SDS-PAGE.
25.6 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
Human BTN3A3 Protein, His Tag [orb1290815]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 24.4 kDa after removal of the signal peptide. The apparent molecular mass of BTN3A3-His is approximately 25-35 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg 
Human BTF3 protein [orb754263]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
22.6 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human BTF3 protein (orb245099)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks