You have no items in your shopping cart.
Human BPHL protein
SKU: orb244872
Description
Research Area
Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 47.1 kDa |
| Expression Region | 1-274aa |
| Protein Length | Full Length of Isoform 2 |
| Protein Sequence | MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−BPHL
Similar Products
−- Item 1 of 1
Human BPHL protein [orb605512]
Greater than 90% as determined by SDS-PAGE.
32.8 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human BPHL protein [orb605513]
Greater than 90% as determined by SDS-PAGE.
32.3 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
Human BPHL protein [orb595110]
Greater than 85% as determined by SDS-PAGE.
32.8 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 1
Human BPHL protein [orb605279]
Greater than 85% as determined by SDS-PAGE.
33.8 kDa
Mammalian cell
1 mg, 20 μg, 100 μg Human BPHL protein [orb605015]
Greater than 85% as determined by SDS-PAGE.
35.8 kDa
E.coli
100 μg, 20 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human BPHL protein (orb244872)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks