You have no items in your shopping cart.
Featured
Description
Research Area
Cardiovascular Research
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 378-477aa |
| Protein Length | Cytoplasmic Domain |
| MW | 12.5 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ADR B1 protein, ADRB 1 protein, ADRB1 protein, ADRB1R protein, Adrenergic beta 1 receptor protein, Adrenoceptor beta 1 protein, B1AR protein, Beta 1 adrenoceptor protein, Beta 1 adrenoreceptor protein, Beta-1 adrenergic receptor protein, Beta-1 adrenoceptor protein, Beta-1 adrenoreceptor protein, BETA1AR protein, RHR protein
Similar Products
−Human Adrenergic Receptor Beta Kinase 1 (ADRbK1) ELISA Kit [orb778487]
Human
0.32-20 ng/mL
0.128 ng/mL
96 T, 48 TGRK2 Rabbit Polyclonal Antibody [orb213536]
IF, IH, KO/KD Validated, WB
Bovine, Canine, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μlGRK2 (Phospho-S29) Rabbit Polyclonal Antibody [orb213535]
IF, IHC, WB
Bovine, Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide













