You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human AR protein
Catalog Number: orb54619
| Catalog Number | orb54619 |
|---|---|
| Category | Proteins |
| Description | Recombinant human AR protein |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT |
| Protein Length | Partial |
| UniProt ID | P10275 |
| MW | 62.4 kDa |
| Application notes | N-terminal 6xHis-SUMO-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged24-189AA: 551-919AAFull Length of Mature Protein: Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 551-919aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Dihydrotestosterone receptor Nuclear receptor subf Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human AREG protein (Active) [orb359172]
> 95% as determined by SDS-PAGE and HPLC.
11.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human DNRA protein [orb418786]
Greater than 90% as determined by SDS-PAGE.
8.8 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial [orb1096599]
Greater than 90% as determined by SDS-PAGE.
55.5 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human AREG Protein, hFc Tag [orb1290823]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.9 kDa after removal of the signal peptide. The apparent molecular mass of AREG-hFc is approximately 53-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human Parkinson Disease Protein 2 (PARK2) ELISA Kit [orb780565]
Human
0.16-10 ng/mL
0.053 ng/mL
96 T, 48 T
