Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-6 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human ACTL8 protein
Catalog Number orb595142
ReactivityHuman
ConjugationUnconjugated
Tested applicationsSDS-PAGE
Sequence Full Length
Target ACTL8
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
Purity >85% as determined by SDS-PAGE.
MW 45.4 kDa
Source Baculovirus
Expression Region 1-366aa
Uniprot ID Q9H568
Product Description

Recombinant Human Actin-like protein 8(ACTL8)

Application Notes
Application Notes Full Length
Reviews
Write Your Own Review
You're reviewing:Human ACTL8 protein - orb595142
Your Rating