HTR3B antibody

• Catalog Number: orb329817
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR3B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: HTR3B
• UniProt ID: O95264
• Protein Sequence: Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
• NCBI: NP_006019
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 5-HT3B antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of mouse Spinal Cord tissue using HTR3B antibody

Western blot analysis of Jurkat cell lysate tissue using HTR3B antibody

Immunohistochemical staining of human Spleen tissue using HTR3B antibody