HTR2B Rabbit Polyclonal Antibody

• Catalog Number: orb573678
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR2B
• Target: HTR2B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2B
• Protein Sequence: Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
• UniProt ID: P41595
• MW: 54 kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 5-HT2B, 5-HT-2B, 5-HT(2B)
• Note: For research use only
• NCBI: NP_000858

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. In addition to the 54 kDa canonical protein, isoforms of 51 kDa and 50 kDa also contain this peptide. Proteins may be lipidated and/or glycosylated as well.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Immunofluorescence: 1.3 ug/ml.

WB Suggested Anti-HTR2B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, HTR2B is supported by BioGPS gene expression data to be expressed in 721_B.