HTATIP2 Rabbit Polyclonal Antibody

• Catalog Number: orb574379
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTATIP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: HTATIP2
• UniProt ID: O15383
• Protein Sequence: Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA
• NCBI: NP_006401
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CC3, TIP30, SDR44U1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Liver

Human Lung

WB Suggested Anti-HTATIP2 Antibody Titration: 0.5-1.0 ug/ml, Positive Control: Jurkat cell lysate.