Cart summary

You have no items in your shopping cart.

    HSPA2 Antibody

    Catalog Number: orb315147

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb315147
    CategoryAntibodies
    DescriptionHSPA2 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, IHC-Fr, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW70021 MW
    UniProt IDP54652
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHeat shock-related 70 kDa protein 2;Heat shock 70
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    HSPA2 Antibody

    Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    HSPA2 Antibody

    WB analysis of HSPA2 using anti-HSPA2 antibody.Lane 1:human HepG2 cell; 2:human HeLa cell; 3:human A431 cell; 4:rat kidney tissue; 5:rat C6 cell; 6:mouse NIH/3T3 cell.

    HSPA2 Antibody

    IF analysis of HSPA2 using anti-HSPA2 antibody.HSPA2 was detected in immunocytochemical section of PC-3 cell.

    HSPA2 Antibody

    IF analysis of HSPA2 using anti-HSPA2 antibody.HSPA2 was detected in immunocytochemical section of PC-3 cell.

    HSPA2 Antibody

    IHC analysis of HSPA2 using anti-HSPA2 antibody. HSPA2 was detected in a paraffin-embedded section of rat intestine tissue.

    HSPA2 Antibody

    IHC analysis of HSPA2 using anti-HSPA2 antibody. HSPA2 was detected in a paraffin-embedded section of human lung cancer tissue.

    HSPA2 Antibody

    IHC analysis of HSPA2 using anti-HSPA2 antibody. HSPA2 was detected in a paraffin-embedded section of mouse intestine tissue.

    • HSPA2 Antibody (monoclonal, 4A4) [orb443135]

      FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • HSPA2 Antibody [orb1564758]

      IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      50 μl, 100 μl, 20 μl
    • HSPA2 antibody [orb378110]

      IF,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • HSPA2 Antibody [orb1244398]

      ELISA,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • HSPA2 antibody [orb678858]

      ELISA,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars