HSPA2 Antibody (monoclonal, 4A4)

• Catalog Number: orb443135
• Category: Antibodies
• Description: HSPA2 Antibody (monoclonal, 4A4)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A4
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 70 kDa
• UniProt ID: P54652
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Heat shock-related 70 kDa protein 2; Heat shock 70
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of HSPA2 using anti-HSPA2 antibody.Lane 1:human HeLa Cell;2:human MDA-MB-231 Cell;3:human COLO-320 Cell;4:human PANC-1 Cell.5:human HT1080 Cell;6:human MDA-MB-453 Cell;7:human HepG2 Cell.

WB analysis of HSPA2 using anti-HSPA2 antibody.Lane 1:rat lung tissue;2:rat liver tissue;3:rat kidney tissue;4:rat testicular tissue;5:mouse lung tissue;6:mouse liver tissue;7:mouse kidney tissue;8:mouse testicular tissue;9:mouse RAW246.7 cell.

IF analysis of HSPA2 using anti-HSPA2 antibody.HSPA2 was detected in immunocytochemical section of PC-3 cells.

IHC analysis of HSPA2 using anti-HSPA2 antibody.HSPA2 was detected in paraffin-embedded section of human lung cancer tissue.