You have no items in your shopping cart.
Cart summary
HSP90AA1 Protein, Pig, Recombinant (His)
Catalog Number: orb1976807
| Catalog Number | orb1976807 |
|---|---|
| Category | Proteins |
| Description | HSP90AA1 Protein, Pig, Recombinant (His) is expressed in Baculovirus insect cells with N-6xHis tag. The predicted molecular weight is 19.7 kDa and the accession number is O02705. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR |
| UniProt ID | O02705 |
| MW | 19.7 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | Baculovirus Insect Cells |
| Biological Origin | Sus scrofa (Pig) |
| Biological Activity | HSP90AA1 Protein, Pig, Recombinant (His) is expressed in Baculovirus insect cells with N-6xHis tag. The predicted molecular weight is 19.7 kDa and the accession number is O02705. |
| Expression Region | 222-367 aa |
| Storage | -20°C |
| Note | For research use only |
