You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315144 |
---|---|
Category | Antibodies |
Description | Hsp90 beta/HSP90AB1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 83264 MW |
UniProt ID | P08238 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Heat shock protein HSP 90-beta;HSP 90;Heat shock 8 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of HSP90AB1 using anti-HSP90AB1 antibody.Lane 1:human A549 cell; 2:human HeLa cell; 3:human Jurkat cell; 4:human K562 cell; 5:human HEK293 cell;6:rat PC-12 cell; 7:mouse NIH/3T3 cell; 8:mouse ANA-1 cell.
IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues.
IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues.
IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues.
IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues.
IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in immunocytochemical section of A431 cells.
IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human placenta tissues.
IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse testis tissues.
IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of rat intestine tissues.
FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating