Hsp90 beta/HSP90AB1 Antibody

• Catalog Number: orb315144
• Category: Antibodies
• Description: Hsp90 beta/HSP90AB1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 83264 MW
• UniProt ID: P08238
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Heat shock protein HSP 90-beta;HSP 90;Heat shock 8
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of HSP90AB1 using anti-HSP90AB1 antibody.Lane 1:human A549 cell; 2:human HeLa cell; 3:human Jurkat cell; 4:human K562 cell; 5:human HEK293 cell;6:rat PC-12 cell; 7:mouse NIH/3T3 cell; 8:mouse ANA-1 cell.

IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues.

IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues.

IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues.

IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues.

IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in immunocytochemical section of A431 cells.

IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human placenta tissues.

IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse testis tissues.

IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of rat intestine tissues.