Hsp90 beta/HSP90AB1 Antibody (monoclonal, 7B7F5)

• Catalog Number: orb1474875
• Category: Antibodies
• Description: Hsp90 beta/HSP90AB1 Antibody (monoclonal, 7B7F5)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7B7F5
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5 μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 90 kDa
• UniProt ID: P08238
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody. Hsp90 beta/HSP90AB1 was detected in an immunocytochemical section of MCF-7 cells.

Western blot analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody.

Flow Cytometry analysis of CACO-2 cells using anti-Hsp90 beta/HSP90AB1 antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.