Hsp90 alpha/HSP90AA1 Antibody

• Catalog Number: orb315143
• Category: Antibodies
• Description: Hsp90 alpha/HSP90AA1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 84660 MW
• UniProt ID: P07900
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Heat shock protein HSP 90-alpha;Heat shock 86 kDa;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of SiHa cells using anti-Hsp90 alpha antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Hsp90 alpha using anti-Hsp90 alpha antibody.Lane 1:human HeLa Cell;2:human HEK293 Cell;3:monkey COS-7 Cell;4:human HepG2 Cell;5:human A549 Cell;6:rat PC-12 Cell;7:rat RH35 Cell;8:mouse HEPA1-6 Cell.

IF analysis of Hsp90 alpha using anti-Hsp90 alpha antibody. Hsp90 alpha was detected in immunocytochemical section of U20S cells.

IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody. Hsp90 alpha was detected in a paraffin-embedded section of rat testis tissue.

IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody. Hsp90 alpha was detected in a paraffin-embedded section of mouse testis tissue.

IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody. Hsp90 alpha was detected in a paraffin-embedded section of human testis tissue.