You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584869 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HSP70 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Goat, Human, Mouse, Rat, Yeast, Zebrafish |
Reactivity | Canine, Goat, Human, Mouse, Rat, Yeast, Zebrafish |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70kDa |
Target | Hspa1a |
UniProt ID | Q61696 |
Protein Sequence | Synthetic peptide located within the following region: KMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINE |
NCBI | NP_034609 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Hsp, Hsp7, Hsp70, Hsp72, hsp68, Hsp70-3, Hsp70.3, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ICC, IHC-P, IP, WB | |
Human, Monkey, Mouse, Other, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IHC-P, WB | |
Canine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Bovine, Equine, Monkey | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating