Cart summary

You have no items in your shopping cart.

    Grp75/HSPA9 Antibody

    Catalog Number: orb315150

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb315150
    CategoryAntibodies
    DescriptionGrp75/HSPA9 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml, Human, Monkey, Mouse Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry(Fixed), 1-3 μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW73680 MW
    UniProt IDP38646
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesStress-70 protein, mitochondrial;75 kDa glucose-re
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Grp75/HSPA9 Antibody

    Flow Cytometry analysis of U937 cells using anti-Grp75 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Grp75/HSPA9 Antibody

    WB analysis of Grp75 using anti-Grp75 antibody.Lane 1:human HeLa cell; 2:human HepG2 cell; 3:human PANC-1 cell; 4:monkey COS-7 cell; 5:human Jurkat cell; 6:human CACO-2 cell; 7:human A549 cell; 8:human SW620 cell; 9:mouse RAW264.7 cell.

    Grp75/HSPA9 Antibody

    IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human gastric cancer tissue.

    Grp75/HSPA9 Antibody

    IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human malignant melanoma cells tissue.

    Grp75/HSPA9 Antibody

    IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human esophageal squamous carcinoma tissue.

    Grp75/HSPA9 Antibody

    IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human metastatic adenocarcinoma tissue.

    • Grp75/HSPA9 Antibody [orb76302]

      ICC,  IHC,  IHC-Fr,  WB

      Hamster

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • Grp75 (HSPA9) antibody [orb1325286]

      FC,  IF,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Grp75 (HSPA9) antibody [orb1325366]

      IF,  WB

      Canine, Human, Monkey, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Grp75 (HSPA9) antibody [orb1325398]

      FC,  IF,  IHC,  WB

      Canine, Human, Monkey, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Grp75 (HSPA9) antibody [orb1338302]

      FC,  IF,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars