You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315150 |
---|---|
Category | Antibodies |
Description | Grp75/HSPA9 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry(Fixed), 1-3 μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 73680 MW |
UniProt ID | P38646 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Stress-70 protein, mitochondrial;75 kDa glucose-re Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U937 cells using anti-Grp75 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Grp75 using anti-Grp75 antibody.Lane 1:human HeLa cell; 2:human HepG2 cell; 3:human PANC-1 cell; 4:monkey COS-7 cell; 5:human Jurkat cell; 6:human CACO-2 cell; 7:human A549 cell; 8:human SW620 cell; 9:mouse RAW264.7 cell.
IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human gastric cancer tissue.
IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human malignant melanoma cells tissue.
IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human esophageal squamous carcinoma tissue.
IHC analysis of Grp75 using anti-Grp75 antibody. Grp75 was detected in a paraffin-embedded section of human metastatic adenocarcinoma tissue.
ICC, IHC, IHC-Fr, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, IHC, WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating