Hsl1 Antibody

SKU: orb153332

Description

Goat polyclonal antibody to Hsl1. It is a large (1,518-residue) protein kinase from Ustilago maydis Hsl1 with an N-terminal catalytic domain and a very long C-terminal extension. Hsl1 localizes to the site of cytokinesis in the bud neck in a septin-dependent manner and promote proper timing of cell cycle progression.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:500-1:2,000
• Reactivity: Fungi
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 100 aa to N-terminus of Ustilago maydis Hsl1 produced in E. coli.. Antigen Sequence: MSSSQRPVVQPIPPFKGAPLQATDVQNRRPTAAEAYVALANRKAGANVVSTRATGCENHRPSQHQPTSHHASQRQQPAPAADRRVQQSQPSERPKPASRLE
• Target: Hsl1
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

UM03928.1 hypothetical protein and cdr2-like protein antibody.

Quick Database Links

Gene Symbol

Hsl1