You have no items in your shopping cart.
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000 |
| Reactivity | Fungi |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 100 aa to N-terminus of Ustilago maydis Hsl1 produced in E. coli. Antigen Sequence: MSSSQRPVVQPIPPFKGAPLQATDVQNRRPTAAEAYVALANRKAGANVVSTRATGCENHRPSQHQPTSHHASQRQQPAPAADRRVQQSQPSERPKPASRLE |
| Target | Hsl1 |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−UM03928.1 hypothetical protein and cdr2-like protein antibody.
Similar Products
−DCPS Antibody [orb1321203]
IHC, Simple Western, WB
Human, Mouse, Rat
Mouse
Monoclonal
Unconjugated
100 μl, 50 μl, 30 μlDCPS Rabbit Polyclonal Antibody [orb156552]
IF, IHC-Fr, IHC-P
Human, Mouse
Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Hsl1
Documents Download
Datasheet
Product Information
Request a Document
Hsl1 Antibody (orb153332)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



