HSH2D Rabbit Polyclonal Antibody

SKU: orb331105

Description

HSH2D Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting HSH2D. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: HSH2D
• Protein Sequence: Synthetic peptide located within the following region: RSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQP
• Molecular Weight: 39kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ALX antibody, anti FLJ14886 antibody, anti HSH2 antibody

Quick Database Links

Gene Symbol

HSH2D

UniProt

Q96JZ2

RefSeq (Protein):NP_116244