Hps3 Rabbit Polyclonal Antibody

• Catalog Number: orb329564
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Hps3
• Target: Hps3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Protein Sequence: Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND
• MW: 113kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Hps3 antibody
• Note: For research use only
• NCBI: NP_001101134

WB Suggested Anti-Hps3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Rat Brain.