HP Rabbit Polyclonal Antibody

SKU: orb333713

Description

Rabbit polyclonal antibody to Haptoglobin

Research Area

Disease Biomarkers, Signal Transduction

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human HP
Target	HP
Protein Sequence	Synthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
Molecular Weight	60 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti Haptoglobin alpha chain antibody, anti Haptoglobin alpha(1S) beta antibody, anti Haptoglobin alpha(2FS) beta antibody, anti Haptoglobin beta chain antibody, anti Haptoglobin, alpha polypeptide antibody, anti Haptoglobin, beta polypeptide antibody, anti HP antibody, anti Hp2 alpha antibody, anti HPA1S antibody, anti HPT antibody, anti Zonulin antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

HP (haptoglobin)antibody - N-terminal region (orb333713), Catalog Number: orb333713, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HP Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

UniProt

P00738

RefSeq (Protein):NP_005134

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_005134

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols