Hoxd13 Rabbit Polyclonal Antibody

SKU: orb329631

Description

Rabbit polyclonal antibody to Hoxd13

Research Area

Cancer Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Hoxd13
• Protein Sequence: Synthetic peptide located within the following region: VPTNEVPARAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISME
• Molecular Weight: 36000
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Hox-4.8 antibody, anti spdh antibody

WB Suggested Anti-Hoxd13 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Spleen.

Quick Database Links

Gene Symbol

Hoxd13

UniProt

P70217

RefSeq (Protein):NP_032301