Hoxc9 Rabbit Polyclonal Antibody

SKU: orb576866

Description

Rabbit polyclonal antibody to Hoxc9

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hoxc9
• Target: Hoxc9
• Protein Sequence: Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ
• Molecular Weight: 29kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Hox-3., Hox-3.2

WB Suggested Anti-Hoxc9 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Testis.

Quick Database Links

Gene Symbol

Hoxc9

UniProt

P09633

RefSeq (Protein):NP_032298