HOXC9 Rabbit Polyclonal Antibody

SKU: orb575645

Description

HOXC9 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of HOXC9. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human HOXC9. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXC9
• Target: HOXC9
• Protein Sequence: Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT
• Molecular Weight: 29kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HOX3, HOX3B

Quick Database Links

Gene Symbol

HOXC9

UniProt

P31274

RefSeq (Protein):NP_008828