HOXC9 Rabbit Polyclonal Antibody

• Catalog Number: orb575645
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXC9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXC9
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: HOXC9
• UniProt ID: P31274
• Protein Sequence: Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT
• NCBI: NP_008828
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOX3, HOX3B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Lung

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-HOXC9 Antibody Titration: 2.5 ug/ml, Positive Control: Transfected 293T.